PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01889.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 409aa    MW: 46766.5 Da    PI: 6.279
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01889.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.92e-49541792128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              +pGfrFhPt+eel+ +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg
  Rsa1.0_01889.1_g00002.1  54 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATG 138
                              79***************************.89***************8778899******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               d+ + s++ +++glkktL+fy+g+apkg++++W+m+eyrl
  Rsa1.0_01889.1_g00002.1 139 ADRMIRSETYRQIGLKKTLIFYSGKAPKGTRSSWIMNEYRL 179
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5553200IPR003441NAC domain
PROSITE profilePS5100555.24653200IPR003441NAC domain
PfamPF023653.2E-2455179IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MTIVSSTTSI ITMMSNQVNN NTEKGIEEDA HRGGHESRVQ NDDEADDHDQ DMVMPGFRFH  60
PTEEELIEFY LRRKVEGKRF NVELITFLDL YRYDPWELPA LAAIGEKEWY FYVPRDRKYR  120
NGDRPNRVTT SGYWKATGAD RMIRSETYRQ IGLKKTLIFY SGKAPKGTRS SWIMNEYRLP  180
HHDTEKYQKA ETSLCRVYKR PGVEDHPSLP RSTSTRQHNH NSSSSSRLAV RQQQQYLPSS  240
SNHSDNNLNN NNNLEKHSTE YSGDGSTITT TNSNSDVTIA LANQNIYRPM PYGASNTTII  300
SNQEDDETAI VDDLQRLVNY QITDGGSNIN HQYYQIAEQF HNQQQLNANA NALQLVTADT  360
TATLTPQTQA ALAMNMIPTG TIPNNALWEM WNPLVPDGNK DHYTSNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-56442008165NAC domain-containing protein 19
4dul_A3e-56442008165NAC domain-containing protein 19
1ut7_B3e-56442008165NO APICAL MERISTEM PROTEIN
1ut7_A3e-56442008165NO APICAL MERISTEM PROTEIN
1ut4_B3e-56442008165NO APICAL MERISTEM PROTEIN
1ut4_A3e-56442008165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0008740.0BT000874.1 Arabidopsis thaliana clone C104984 putative NAM (no apical meristem) protein (At2g02450) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675927.10.0PREDICTED: NAC domain-containing protein 72-like isoform X1
RefseqXP_013675928.10.0PREDICTED: NAC domain-containing protein 72-like isoform X2
SwissprotQ9FIW54e-62NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A078FN110.0A0A078FN11_BRANA; BnaC02g34540D protein
STRINGBra026595.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54362750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.20.0NAC domain containing protein 35